wisp - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Wisp: 1,417 results found.

wispsystems.net Wireless Internet Service Providers - WISP. Internet Service Providers - ISP. T1 Wireless DS1 Lines T3 Wireless DS3 Lines, P2P, MPLS Solutions, Telecommunications Consultants and Network Professionals: Welcome to WISPSYSTEMS.NET!
Locate Wireless T1, Wireless T3, DS1 Lines, DS3 Lines, Wireless Bandwidth, Broadband Connectivity, Telecommunications Solutions in Real Time or by a Live Communications Consultant.
Wispsystems.net  ~   Site Info   Whois   Trace Route   RBL Check  
etziahaircouture.com Baby Wisp - Urban Baby Goods & Accessories.
Welcome to the Kingdom of Baby Wisp! The magical place where little baby wispies can now have baby hair clips added so she's no longer mistaken for a boy! Baby Wisp Latch clips stay in place and only come off when you want them to. These baby hairclips are the perfect size, weight, modern designed hairbows, ribbons, crochet flowers and genius engineering you've been waiting for. Easy to use without disturbing baby. This is an exclusive product only available on www.babywisp.com. Join the baby wisp revolution!
Etziahaircouture.com  ~   Site Info   Whois   Trace Route   RBL Check  
isp-soft.com MikroManager Soft Control Gestin ISP Wisp Integracion Mikrotik
Sistema de Gestion de ISP WISP con Integracion a Mikrotik
Isp-soft.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: isp-soft.net
fixedwirelessproviders.net 3G Fixed Wireless Provider 4G WISP and Wireless 4G 3G Internet Service Providers Bandwidth Providers
3G Fixed Wireless Provider 4G WISP and Wireless 4G 3G Internet Service Providers Bandwidth Provider Connection Prices in Real Time.
Fixedwirelessproviders.net  ~   Site Info   Whois   Trace Route   RBL Check  
petfriendlyrentalsdeepcreeklake.com Pet Friendly Travels at WISP & Deep Creek Lake
Pet Friendly lodging in Western MD, convenient to Deep Creek Lake and WISP Ski Resorts. Rental homes professionally managed by Offlake Rentals.
Petfriendlyrentalsdeepcreeklake.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: petfriendlytraveldeepcreeklake.com
wispcommunications.com Wisp Communications: Your IT Fire Department!
WispCommunications Website Templates and Pre-Made Websites. Very reasonable prices and a complete setup.
Wispcommunications.com  ~   Site Info   Whois   Trace Route   RBL Check  
skynetengineering.com Skynet Engineering | Broadband Wireless WISP Construction Services
Skynet provides wireless broadband services, easy high speed Internet and data services, wired and wireless networking, IT maintenance, PC repair, Qscan and jack trim hubs, security software configuration, access control and surveillance cameras.
Skynetengineering.com  ~   Site Info   Whois   Trace Route   RBL Check  
wearewireless.net wearewireless.net - Home
Midwest WISP
Wearewireless.net  ~   Site Info   Whois   Trace Route   RBL Check  
wisp-training.es MikroTik Training
MikroTik Schulungen und Zertifizierung | Mikrotik training and certification
Wisp-training.es  ~   Site Info   Whois   Trace Route   RBL Check  
wispsystem.org Wi Fi T1 Wireless, WIMAX T3 Wireless, Wireless Bandwidth, Wired Bandwidth, Broadband Connectivity, Ethernet Connectivity, T1 Line and T3 Line Providers: Welcome to WISPSYSTEM.ORG!
Wi Fi and WiMAX Connectivity and Solutions Providers for Wireless T1's, Wireless T3's, Bandwidth Wireless, WISP Solutions, ISP Solutions, etc. MPLS, VPN, PBX, VPBX, Bandwidth T1 Lines, Bandwidth T3 Lines, Telecommunications Systems and Protocols.
Wispsystem.org  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 9/87« Previous7891011Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com