tatoc - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Tatoc: 37 results found.

tatoc.net Welcome to TATOC the Timeshare Association
TATOC The Timeshare Association
Tatoc.net  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: tatoc.org - tatoc.co.uk - timeshareassociation.org
sharetimemagazine.com Welcome to Sharetime Magazine
Sharetime Magazine - The magazine from the Timeshare Association.
Sharetimemagazine.com  ~   Site Info   Whois   Trace Route   RBL Check  
timeshareconsumeradvice.org Timeshare Consumer Advice line
Timeshare Consumer Advice
Timeshareconsumeradvice.org  ~   Site Info   Whois   Trace Route   RBL Check  
eliteclubresortstimeshareresale.com Home - Worldwide Timeshare Hypermarket
Timeshare Developers
Eliteclubresortstimeshareresale.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: eliteclubresortstimeshareresale.co.uk - puebloevitatimeshareresales.com - puebloevitatimeshareresales.co.uk
timeshare-consumer-advice.com Home
Timeshare Consumer Advice has Timeshare news and information on buying Timeshare selling Timeshare and Timeshare law
Timeshare-consumer-advice.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: timeshare-consumer-advice.co.uk
anfisalesuk.com Buy Timeshares - Sell Timeshare - Worldwide Timeshare Hypermarket
Worldwide Timeshare Hypermarket is the place to go if you are thinking of buying or selling a timeshare.We sell all the top resorts i.e. Anfi Beach Club, Marriotts,Devere Group and Club la Costa and Seasons PLC to name a few. If you are thinking of either buying or selling a timeshare then call Worldwide Timeshare Hypermarket first. See us on National and Sky Television as well as in all the major newspapers.Worldwide Timeshare Hypermarket will always get you the best deal.Members of RDO & TATOC
Anfisalesuk.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: anfitimeshare.com - buy-anfi.com - buyanfi.com - macdonaldtimeshareresales.com - seasonsplctimeshareresales.com - timeshare-hypermarket.com - timeshare-uk.co.uk - visionsoftheworldtimeshareresales.com - world-widepoints.com - world-widepoints.net - worldwidepoints.net - worldwidetimeshare-hypermarket.com - worldwidetimesharehypermarket.com - worldwidetimesharehypermarket.net - worldwidetimesharehypermarket.org - wwth.net
wallnet.ru WALLNET.ru - Домашняя страница
WALLNET.ru - социальная сеть домашних страниц. Найти друзей, одноклассников, однокурсников. Создать домашнюю страницу. Создать страничку. Смотреть фотографии. Установить домашнюю страницу
Wallnet.ru  ~   Site Info   Whois   Trace Route   RBL Check  
rciventures.com RCI Ventures | Timeshare news
Timeshare news, fractional news, sharing success stories in shared ownership.
Rciventures.com  ~   Site Info   Whois   Trace Route   RBL Check  
diamondresortsresales.co.uk Buying & Selling Diamond Resorts Points | Buy & Sell DRI Points
Buying or selling Diamond Resorts European Collection (DRI) Points? Diamond Resort Resales are the ONLY authorised European collection points reseller.
Diamondresortsresales.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
timeshare-beat.com Timeshare Beat
Welcome to Timeshare Beat. The place to find Timeshare stories & headlines on Timeshare, Timeshare News, Fractional News, Hospitality Headlines, The Timeshare Blog, Fractional Ownership, Destination Clubs, Private Residence Clubs, Real Estate
Timeshare-beat.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 1/2« Previous12Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com