spouses - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Spouses: 3,332 results found.

cstcsandiego.org CSTC - San Diego Chapter Home Page
education and networking for tax professionals san diego
Cstcsandiego.org  ~   Site Info   Whois   Trace Route   RBL Check  
ironcladinvestigation.com California Private Investigator
Private Investigative Services in California including background checks, cheating spouses, surveillance and sub rosa, bug sweeps, location services and more.
Ironcladinvestigation.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: ironcladinvestigations.com
manila-legal.com Manila Legal | Philippines Legal Information | Philippine Laws | Philippine Recent Court Cases
How To Enter Into Prenuptial Agreements In The Philippines Philippine law, specifically the Family Code, allows future spouses to fix their property relations
Manila-legal.com  ~   Site Info   Whois   Trace Route   RBL Check  
realestatedefaultgroup.com beFrank
beFrank
Realestatedefaultgroup.com  ~   Site Info   Whois   Trace Route   RBL Check  
wcdlawhawaii.com Hawaii Family Law Attorneys | Honolulu Complex Divorce Lawyers | The Law Offices of William C. Darrah
For over 30 years, the law office of William C. Darrah has been representing spouses in family law and matrimonial matters involving complex divorces with complicated financial concerns throughout Honolulu and Hawaii.
Wcdlawhawaii.com  ~   Site Info   Whois   Trace Route   RBL Check  
youhaveorders.com You Have Orders - Let's face it: Moving is stressful and in the military we move a lot! You Have Orders is a place for us all to connect and share our favorites, and not so favorites, of the places we have lived before in hopes to make all of our moves a little bit easier
Let's face it: Moving is stressful and in the military we move a lot! You Have Orders is a place for us all to connect and share our favorites, and not so favorites, of the places we have lived before in hopes to make all of our moves a little bit easier
Youhaveorders.com  ~   Site Info   Whois   Trace Route   RBL Check  
docadl.org DOCADL
Descendants of Clifford and Dorothy Lance
Docadl.org  ~   Site Info   Whois   Trace Route   RBL Check  
flaxer.org Home - Flaxer.Org Website
Flaxer.Org Website
Flaxer.org  ~   Site Info   Whois   Trace Route   RBL Check  
greenwichfamilytherapy.com Linda Schlapfer | Marriage, Couples and Family Therapy | Greenwich, CT
Linda Schlapfer is a licensed marriage and family therapist in Greenwich, Connecticut. She specializes in helping individuals, couples, children and families untangle the complexities of their relationships.
Greenwichfamilytherapy.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: greenwichmarriagecounseling.com - greenwichmarriagefamilytherapy.com - greenwichmarriagetherapy.com - lindaschlapfer.com
militaryspot.net Military Friends Network
social networking for the military community
Militaryspot.net  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 46/163« Previous4445464748Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com