Southaven

Southaven: 1,347 results found.

Hairlines Salon of Southaven Offers the Best Hair Cuts and Styles
Welcome to Hairlines Salon, make an appointment (662)349-8898 or just walk-in. Our success has been built around one simple goal: Making sure you get exactly the hair cut or style you want.
Hairlinessalon.net ~ Site Info Whois Trace Route RBL Check

Jane's Gym: 24-Hour Gym & Fitness Center for Women - Southaven & Olive Branch, MS
Jane's Gym, located in Olive Branch, MS, is Desoto County's newest, upscale wellness & fitness center exclusively for women!
Janesgym.com ~ Site Info Whois Trace Route RBL Check

Country Ford | Memphis Ford Dealers, New, Used Car, Ford Cars, Trucks, Sales, Service, Southaven, Memphis TN, Olive Branch MS
Memphis Ford Dealership. Sales, Service, Selection, Savings, New Fords, Used Cars & Trucks, Research, Get Quotes, Compare Prices, Auto Parts, Arrange Finance, Specials; Southaven, Memphis TN, Olive Branch, Mississippi.
Countryford.com ~ Site Info Whois Trace Route RBL Check

Quality Ultra Print, Inc. - Certified Minority Owned Commercial Printing in Mississippi
Quality Ultra Print is a commercial printing and graphic design company specializing in direct mail marketing services. Conveniently located in Southaven, Mississippi, and just a few minutes from FedEx and UPS shipping stations in Memphis, Tennessee.
Qualityultraprint.com ~ Site Info Whois Trace Route RBL Check

Southern Inn & Suites Hotel in Southaven, Mississippi | Hotels near Beale Street & Graceland Memphis TN
If youre staying in downtown Memphis, looking for Hotels near Graceland, or hotels near Memphis International Airport, Southern Inn hotel in Southaven is located just 5 miles from the airport and minutes from Graceland and Beale Street.
Southerninnsouthaven.com ~ Site Info Whois Trace Route RBL Check

Memphis Real Estate | Germantown Homes for Sale | Collierville, Southaven, Olive Branch, Bartlett, L
Prudential Collins-Maury
Collinsmaury.com ~ Site Info Whois Trace Route RBL Check
Similar Sites: collins-maury.com

Olive Branch,Desoto County,Southaven, Hernando, Memphis Real Estate
Olive Branch real estate and homes for sale in Olive Branch. Search all Olive Branch MLS listings for sale.. Memphis area real estate and homes for sale in Memphis area. Search all Memphis area MLS listings for sale.
Suedye.com ~ Site Info Whois Trace Route RBL Check

mississippicriminaldefenselawyer-blog.com

Mississippi Criminal Defense Lawyer Blog :: Published by Southaven, Mississippi Criminal Defense Lawyer :: The Stroud Law Firm
Published By The Stroud Law Firm
Mississippicriminaldefenselawyer-blog.com ~ Site Info Whois Trace Route RBL Check

3Monkeys
3 Monkeys Monogramming: Local home-business out of Southaven, Mississippi specializing in custom embroidery and monogramming. Available to customize my merchandise or yours. Call 901-604-2748 or email me at Lindsay@3MonkeysMonogramming.com
3monkeysmonogramming.com ~ Site Info Whois Trace Route RBL Check

Southaven Commercial and Corporate Law Attorneys | Mississippi Eminent Domain and Condemnation, Family Law and Criminal Defense Lawyers, Law Firm - Bridgforth %26 Buntin, PLLC
Southaven Commercial and Corporate Law Attorneys of Bridgforth & Buntin, PLLC pursue cases of Commercial and Corporate Law, Eminent Domain and Condemnation, and Family Law and Criminal Defense in Southaven Mississippi.
Bridgforthbuntin.com ~ Site Info Whois Trace Route RBL Check