perfectly - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Perfectly: 12,351 results found.

perfectlyeasywebsites.com Perfectly Easy Websites — The Easy Way to Get a Professional Website!
Perfectly Easy Websites helps small business and SOHO owners get their business online faster. Based on the WordPress software, owners can actually manage their own content once their site is up and running. It’s the easy way to get a professional website!
Perfectlyeasywebsites.com  ~   Site Info   Whois   Trace Route   RBL Check  
perfectlystreakfree.com Perfectly Streak Free Microfiber Cloths
Perfectly Streak Free offers the original streak free microfiber cloths at a fraction of the prices. Cleans all surfaces streak free, spot free, lint and dust free. Guaranteed!
Perfectlystreakfree.com  ~   Site Info   Whois   Trace Route   RBL Check  
perfectlyposhcreations.com Home - Perfectly Posh Creations by Andria
Event Planning & Designs
Perfectlyposhcreations.com  ~   Site Info   Whois   Trace Route   RBL Check  
perfectlypuresolutions.com Perfectly Pure Solutions Niagara Inc.
Perfectly Pure Solutions Niagara supplies water purification systems for residential, commercial, industrial, and custom desgined systems. Reverse osmosis, ultraviolet, membrane based systems and more.
Perfectlypuresolutions.com  ~   Site Info   Whois   Trace Route   RBL Check  
livinglifeperfectlyimperfect.com Living Life Perfectly Imperfect ® - Flash Intro
Living life on an imperfect road leads us to the end of the road perfectly
Livinglifeperfectlyimperfect.com  ~   Site Info   Whois   Trace Route   RBL Check  
perfectlyclear.co.uk Perfectly Clear - Pure Water Commercial Window Cleaning
Commercial window cleaning using the Wash & Reach pure water system for businesses in the South and West Midlands
Perfectlyclear.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
perfectlyportrayed.com Perfectly Portrayed Photography by Lisa Chapieski
Baby, Child and Family Photographer. North Delta, White Rock, Surrey, Ladner, South Surrey, maternity, newborn, baby, children, family photographer in North Delta BC. Creative family photographer!
Perfectlyportrayed.com  ~   Site Info   Whois   Trace Route   RBL Check  
acookiecottage.com The Cookie Cottage - Home
Welcome to A Cookie Cottage,Your cookie specialist. We have a large selection of cookie arrangements, cookie baskets, cookie cakes and plush animal gifts that can be shipped all over the United States. Our cookies are not baked until you order them. We have cookies for every occasion from Birthdays to Cheerleading and Dance! You can choose from one of our designs or customize one to meet your needs. So, If you do not see what you are looking for, give us a call and let us help you make the perfect arrangement.
Acookiecottage.com  ~   Site Info   Whois   Trace Route   RBL Check  
coloradospringsradio.com Perfectly Matched Dating of Colorado Springs, Colorado
Colorado Springs Premier Dating & Matchmaking Service Since 1987. Let Donna help you find your special romantic connection.
Coloradospringsradio.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: perfectlymatcheddating.com
fittingtees.com Fitting Tees... Apropos Tees--Perfectly Fitting!
Fitting Tees... Apropos Tees--Perfectly Fitting!
Fittingtees.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 13/577« Previous1112131415Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com