mischievous - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Mischievous: 557 results found.

cristinavalero.es Cristina Valero
Homepage Cristina Valero Animation and Illustration
Cristinavalero.es  ~   Site Info   Whois   Trace Route   RBL Check  
air-fairies.com Air Fairies
Information and free clip art of fairies especially air fairies or faery
Air-fairies.com  ~   Site Info   Whois   Trace Route   RBL Check  
jtroycartoons.com Home - John Troy's Books
Fishing & Hunting cartoon books, including BEN. New books in full color!
Jtroycartoons.com  ~   Site Info   Whois   Trace Route   RBL Check  
pugchecks.net Pug Checks, Pug Personal Checks
Pug Checks — Get coupon codes and save 50% on your next order of Pug personal checks.
Pugchecks.net  ~   Site Info   Whois   Trace Route   RBL Check  
jeanyates.co.uk Welcome to my Web site
The World according to Drummer Yates, The Blog from the Dog
Jeanyates.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
marathondogs.com Dog Running Service, Marathon Dogs is the Premier Dog Running Service in Flagstaff
Marathon Dogs is Flagstaff Arizona's premier dog running service. Better than a dog walking service, run running will better exercise your pet, leading to a healthier, happier, and less mischievous pooch.
Marathondogs.com  ~   Site Info   Whois   Trace Route   RBL Check  
santashelperonline.com The Elf on the Shelf: A Christmas Tradition
Elf on the Shelf - A Christmas Tradition ! HELLO I am Cullie, I am 10 years old. I have had my own Elf on the Shelf for 4 years. I look more [The Elf on the Shelf: A Christmas Tradition] forward to the Elf coming rather than Santa. I am so into the Elves that I begged my parents to loan me the money to start my own business selling Elf on the Shelf. My Elf is named Zack.
Santashelperonline.com  ~   Site Info   Whois   Trace Route   RBL Check  
ghoststories.ws Ghost Stories | Scary Stories | Horror Stories
Large collection of true ghost stories, scary stories, and horror stories. Share your paranormal experience with us.
Ghoststories.ws  ~   Site Info   Whois   Trace Route   RBL Check  
punkdogcellar.com Punk Dog Wines
Punk Dog Wines - Where we take fun seriously! Our goal is to create wines that are big, bold mischievous, and slightly edgy with enough character to keep you grinning from ear to ear.
Punkdogcellar.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: punkdogvineyard.com - punkdogwine.com - punkdogwinery.com - punkdogwines.com
slipsandfallslawyermeridenct.com Connecticut Slips And Falls Accident Lawyer, Attorney Steve Jacobs, slipsandfalls accident injury lawyer Connecticut, Jacobs and Jacobs P.C.
The Law office of Slips And Falls Accident Attorney - Lawyer Jacobs and Jacobs in Meriden, CT
Slipsandfallslawyermeridenct.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 15/32« Previous1314151617Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com