mifflin - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Mifflin: 1,159 results found.

mifflincountyhistoricalsociety.org Mifflin County, PA Historical Society
Historical and genealogical researchers resource for Mifflin County and central Pennsylvania.
Mifflincountyhistoricalsociety.org  ~   Site Info   Whois   Trace Route   RBL Check  
westmifflinlions.org West Mifflin Lions Club
We are a group of individuals (men & women) in our community who volunteer their time for humanitarian causes in West Mifflin, PA , regional
Westmifflinlions.org  ~   Site Info   Whois   Trace Route   RBL Check  
homevillevfc.org West Mifflin #1 VFC "Homeville"
West Mifflin #1 VFC "Homeville" - Fire and Rescue for West Mifflin, pa Hall and Sign Rentals Available
Homevillevfc.org  ~   Site Info   Whois   Trace Route   RBL Check  
supportfortmifflin.com Support Fort Mifflin
A WebsiteBuilder Website
Supportfortmifflin.com  ~   Site Info   Whois   Trace Route   RBL Check  
westmifflinbeautyschool.com West Mifflin Beauty School
Our West Mifflin beauty school location can get you started on your promising future in hair and nails.
Westmifflinbeautyschool.com  ~   Site Info   Whois   Trace Route   RBL Check  
sandpiperbooks.com Houghton Mifflin Books for Children
Houghton Mifflin Books for Children
Sandpiperbooks.com  ~   Site Info   Whois   Trace Route   RBL Check  
buyfalloutpa.com Skateboards & Equipment West Mifflin, PA - Fallout Skate Shop
Fallout Skate Shop offers skateboards, accessories, apparel and more to the West Mifflin, PA and surrounding areas. Call 412-462-2500.
Buyfalloutpa.com  ~   Site Info   Whois   Trace Route   RBL Check  
downloadereference.com Houghton Mifflin Harcourt eReference
eReference is a sophisticated search tool that includes the full print-version texts of The American Heritage® Dictionary of the English Language, Fourth Edition, and Roget's II: The New Thesaurus, and more: if you're connected to the Internet, for example, you can get real voice pronunciations and brilliant color images.
Downloadereference.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: ereference.com - ereferenceupdate.com - ereferenceupdate.net - ereferenceupdate.org
westmifflinpennsylvaniahairschool.com West Mifflin Pennsylvania Hair School
Be all you can be at the West Mifflin PA cosmetology school, by learning all about a career in cosmetology .
Westmifflinpennsylvaniahairschool.com  ~   Site Info   Whois   Trace Route   RBL Check  
westmifflinpa.com West Mifflin, Pennsylvania (PA) Hotels, Yellow Pages, Homes, Weather, Apartments, Jobs, and more
City of West Mifflin, Pennsylvania. Find hotels, homes, jobs, apartments, yellow pages, and events in West Mifflin. Also weather, restaurants, schools, businesses, city information and other info for West Mifflin.
Westmifflinpa.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 4/71« Previous23456Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com