krisztian - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Krisztian: 56 results found.

vacarpentry.com Home improvement,complete kitchen remodel with free estimate.
Home improvement,complete kitchen remodel with free estimate.
Vacarpentry.com  ~   Site Info   Whois   Trace Route   RBL Check  
whatelsemagazine.com WHAT ELSE MAGAZINE - Fashion and Art Magazine App
What Else Magazine is a Fashion and Art Magazine App.We are an international Fashion and Art collective founded in East London. We have created a platform to curate the progressive talents from the cutting edge of Fashion, Art, Photography and Journalism.
Whatelsemagazine.com  ~   Site Info   Whois   Trace Route   RBL Check  
cadavercourses.com Cadaver Courses - Human Cadaver Course
Cadaver Courses - This course is a unique hands-on experience. It offers opportunity for each participant learn a full spectrum of rhinoplasty techniques in a step-by-step fashion.
Cadavercourses.com  ~   Site Info   Whois   Trace Route   RBL Check  
krisztianbalog.com Krisztian Balog
krisztianbalog krisztian balog entity search trec workshop posts view semantic filed comment challenge leave oriented research web semsearch overview sigir yahoo report cfp papers update switching colours milestone thesis march rss notification acceptance data conference science april list lhd talks
Krisztianbalog.com  ~   Site Info   Whois   Trace Route   RBL Check  
talalkahely.hu Bejelentkezés - Találkahely
talalkahely bejelentkezés találkahely szkati izabel fruzs zolika krisztian elfelejtettem felhasználási feltételek jelszavam adatvédelem online krisztia kapcsolatfelvétel tagunk név napja rudolf április jelszó privát van jelenleg tiltása chat ebből
Talalkahely.hu  ~   Site Info   Whois   Trace Route   RBL Check  
tedor.info Krisztian Hofstadter | tEdor : tEdor.info
tedor, tEdör, Krisztian Hofstadter, Krisztián Hofstädter, cambridge, composer for media, composer for game music, composer for art movies, composer for websites, EEG, music for movies, music for games, music for film, music for websites, human computer interaction, HCI, sonification, brain waves, IBVA, electronic music, experimental music, szinusz radio, periszkop radio pecs, anglia ruskin university, creative music technology,
Tedor.info  ~   Site Info   Whois   Trace Route   RBL Check  
gesprek.net www.gesprek.net
gesprek net www cwafrica anna emily phil hendrik krisztian july annacwafricaemilyhendrikphilkrisztianlast restricted server users select links changed
Gesprek.net  ~   Site Info   Whois   Trace Route   RBL Check  
kstafford.com Kelly Stafford Make-Up London
kstafford kelly make stafford london home contact atom zana friends krisztian looks posts natural copy chloe small photography com subscribe professional googlemail dot kvstafford living working artist edit flickr post dash rss rsd blogger navigation search michelle
Kstafford.com  ~   Site Info   Whois   Trace Route   RBL Check  
dombradi.com uniblog
dombradi uniblog pdf kommunikáció krisztian com eletrajz web mailto írta kérdés részvételről kollektív stratégiai bikini american dajnoki inforadio photos krisztina stock összefüggései vezetés problémamegoldásról életrajz communicatio fickr kötelező jel kép irodalom üzenet jurnal szervezetszociológia journal dombrádi lesz uses limited pls
Dombradi.com  ~   Site Info   Whois   Trace Route   RBL Check  
horvathkrisztian.com Horváth Krisztián honlapja
horvathkrisztian krisztián horváth honlapja stúdió technika kezdőlap képek referenciák kreafilm letöltések elérhetőség horvath contact krisztian kellemes köszöntöm honlapomon szeretettel kezdőlapstúdiótechnikaképekreferenciákelérhetőségletöltésekkreafilmstúdió hivatalos kérem válasszon böngészést közül menüpontok fenti kívánok
Horvathkrisztian.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 3/4« Previous1234Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com