kohnen - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Kohnen: 105 results found.

pheasants-hunting-sd.com SD Pheasant Hunting at Kohnen's Dakota Pheasant Acres
South Dakota Pheasant Hunting - experience a pheasant hunt of a life time at Kohnen's Dakota Pheasant Acres!
Pheasants-hunting-sd.com  ~   Site Info   Whois   Trace Route   RBL Check  
dekorationsmaler.com Malermeister Kohnen - Restaurator im Handwerk
Ausführung sämtlicher Malerarbeiten, dekorativer und historischer Techniken, bis zur Wandmalerei und Vergoldung. Restaurierung von Historischen Malereien und Oberflächen, in klassischen Techniken. Dekorieren von Schaufenstern und Geschäftsbereichen, saisonal oder nach Wunsch.
Dekorationsmaler.com  ~   Site Info   Whois   Trace Route   RBL Check  
laceykohnen.com Ryan Kohnen | Speaking to Your Generation
Ryan specializes in motivating college students, empowering Gen Y employees, and leading management groups on how to motivate and engage this next generation.
Laceykohnen.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: ryankohnen.com - ypsuccess.com
portugalhaus-hamburg.com Gabinete KOHNEN & KRAG Rechtsanwälte in Hamburg und Dortmund
Die Kanzlei Kohnen & Krag Rechtsanwälte mit Sitz in Hamburg und Dortmund berät Sie in allen juristischen Angelegenheiten.
Portugalhaus-hamburg.com  ~   Site Info   Whois   Trace Route   RBL Check  
judithkohnen.com Judith Kohnen, Author of Romance & More
writing
Judithkohnen.com  ~   Site Info   Whois   Trace Route   RBL Check  
couleurcerise.com Couleur Cerise
Boutique de mode féminine à Valenciennes. Pour vous, nous avons choisi une mode ludique où vous jouerez avec les styles pour créer un look unique...le votre!
Couleurcerise.com  ~   Site Info   Whois   Trace Route   RBL Check  
dart-sport.com darts billard trophy sport shop Andreas Kohnen
large assortment of dart products: electronic darts boards, flights, barrels etc.
Dart-sport.com  ~   Site Info   Whois   Trace Route   RBL Check  
beavercreekfamilyphysicians.com Beavercreek Family Physicians
Beavercreek Family Physicians has served the medical needs of the Beavercreek community for over 30 years.
Beavercreekfamilyphysicians.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: beavercreekfamilyphysicians.net - beavercreekfamilyphysicians.org
stadtpanorama.net editionbek.de - Köln Panorama Kalender 2011
Björn-Eric Kohnen, Bildgestalter Kamera, Fotografien von Köln
Stadtpanorama.net  ~   Site Info   Whois   Trace Route   RBL Check  
spd-aying.de Homepage - SPD Aying
Internetauftritt des SPD Ortsvereins Aying
Spd-aying.de  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 2/7« Previous12345Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com