floortime - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Floortime: 128 results found.

thekidsprogram.com Kolchins/Thomas Infant Development Services
The K.I.D.S. Program Home
Thekidsprogram.com  ~   Site Info   Whois   Trace Route   RBL Check  
joannefinnlep.com Joanne C. Finn, M.A., Licensed Educational Psychologist
Services of Joanne C. Finn, LEP #3058
Joannefinnlep.com  ~   Site Info   Whois   Trace Route   RBL Check  
basadriaanshelpt.info Bas Adriaans | Ambulante begeleiding van kinderen met een ontwikkelingstoornis | Amsterdam
Welkom op de website van Bas Adriaans. Pedagogische thuisbegeleiding voor kinderen met een ontwikkelingsstoornis in de omgeving Amsterdam. Ook floortime methode en algemene pedagogische begeleiding.
Basadriaanshelpt.info  ~   Site Info   Whois   Trace Route   RBL Check  
autismprogram.com AutismWeb: The Parent's Guide to Autism Spectrum Disorders
A parents' guide to the diagnosis, education and treatment of children with autism, Pervasive Developmental Disorder (PDD) and Asperger's Syndrome.
Autismprogram.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: autismsymptoms.net - autismweb.com - autismweb.info - autismweb.net - autismweb.org - autismwebsite.org - fightingautism.com - pddhelp.com
pedptot.com Rosemary White | Rosemarywhite | Pediatric PT & OT Services
Rosemary White, Rosemarywhite, Pediatric PT OT Services
Pedptot.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: rosemarywhitepediatricservices.com
gurryautismconsulting.com home
Consulting to families and schools regarding autism education and behavior.
Gurryautismconsulting.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: gurryconsulting.net
speech-links.com Speech Links - Bilingual Speech Language Pathology in West Palm Beach
Speech Links located in West Palm Beach provides specialized, home-based pediatric speech therapy for children with apraxia, autism, pervasive developmental disorders, develomental delays, and disorders of articulation, fluency, voice, feeding-swallowing disorders, auditory processing disorders and language disorders. Treatment strategies used include PROMPT, DIR Floortime, Therapeutic Listening, Sensory Integration and Auditory Processing.
Speech-links.com  ~   Site Info   Whois   Trace Route   RBL Check  
celestetherapeutics.com Home
Professional Service
Celestetherapeutics.com  ~   Site Info   Whois   Trace Route   RBL Check  
praktijkkinderfysiotherapie.nl Kinderfysiotherapie praktijk - AMSTERDAM
Kinderfysiotherapie Amsterdam
Praktijkkinderfysiotherapie.nl  ~   Site Info   Whois   Trace Route   RBL Check  
autistic-like.com Autistic-Like: Graham's Story -- A film by Erik Linthorst | Autism Film
When it's not autism, what is it? See this new documentary! The film includes information on autism symptoms, sensory integration, sensory processing disorder, developmental delay, PDD, high functioning autism, Floortime therapy and much more.
Autistic-like.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: autisticlike.com
 


Page 3/8« Previous12345Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com