fertigation - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Fertigation: 270 results found.

fmwaterways.com Home Page
Friends of Maitland's Waterways is a Maitland citizens' group who educate the public, through its newsletter Waterways, about lake pollution by phosphorus from fertilizers, which promote algae growth and eutrophication.
Fmwaterways.com  ~   Site Info   Whois   Trace Route   RBL Check  
tricomps.com Tricomp Automation Limited
Tricomp Automation Limited - A comprehensive solution for Agricultural Automation
Tricomps.com  ~   Site Info   Whois   Trace Route   RBL Check  
bostonareasprinklers.com N.E. Irrigation - Enhancing Landscapes Since 1966.
N. E. Irrigation. Enhancing landscapes since 1966. Learn about residential and commercial sprinkler systems, fertigation and nightscaping – with guaranteed results. 866-634-7744
Bostonareasprinklers.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: bostonfertigation.com - connecticutfertigation.com - connecticutlawnsprinklers.com - massachusettsfertigation.com - massachusettslawnsprinklers.com - neict.com - neinj.com - neiny.com - neirrigation.com - neirrigationconnecticut.com - neirrigationct.com - neirrigationma.com - neirrigationnj.com - neirrigationny.com - newenglandfertigation.com - newenglandirrigationct.com - newenglandirrigationinc.com - newenglandirrigationincct.com - newenglandlawnsprinklers.com - newenglandlawnsprinklersystems.com - newenglandnightlighting.com - newenglandnightscaping.com - newenglandsprinklers.com - northeastirrigation.com - northeastlawnsprinklers.com - northeastsprinklers.com - northeastturfirrigation.com - northeastturfsprinklers.com
irripronews.com irripronews
We offer advice and guidance from a twenty year expert on commercial irrigation and fertigation. Our web site includes in-depth case studies in a number of settings. />
Irripronews.com  ~   Site Info   Whois   Trace Route   RBL Check  
fertitech.com Ferti-Tech Australia - Manufacturer and Broker of specialised Biological Organic Conventional & Mineral Fertilisers.
Manufacturer and Established Broker of specialised Biological-Organic-Conventional & Mineral Fertilisers.
Fertitech.com  ~   Site Info   Whois   Trace Route   RBL Check  
jains.com Jain Irrigation Systems Ltd.
Manufacturer Exporter Quality irrigation systems, pipes and fittings, plastic sheets, food
Jains.com  ~   Site Info   Whois   Trace Route   RBL Check  
fertigator.com Fertigator - Automatic Fertilization for Irrigation Systems
Automatic Fertilization for Irrigation Systems
Fertigator.com  ~   Site Info   Whois   Trace Route   RBL Check  
greensandthings.net Greens & Things Plantscaping
Greens and Things Plantscaping is located in north San Diego County. Services include creative design and installation of interior plants and patio plantscaping, watering, Cleaning and pruning, repotting of plants as needed, color rotation, Purchasing and Selection of Plant Material, Orchid Arrangements, Patio Container Plants, Fertigation and Organic Solutions.
Greensandthings.net  ~   Site Info   Whois   Trace Route   RBL Check  
newaginternational.com New Ag International - The leading world publication on High Tech agriculture
New Ag International - the leading agriculture magazine covering speciality fertilizers, fertigation, foliar spray, irrigation, water management, greenhouses and other farm inputs such as organic and slow release fertilizers.
Newaginternational.com  ~   Site Info   Whois   Trace Route   RBL Check  
naturallandscapesolutions.com Natural Landscape Solutions - Lawn care, organic lawn fertilizer, liquid fertilizer, liquid aeration, soil conditioner
We offer lawn care products such as organic lawn fertilizer, liquid fertilizer, lawn aeration, and soil conditioner.
Naturallandscapesolutions.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: organiclawncaresolutions.com
 


Page 7/16« Previous56789Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com