conviction - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Conviction: 5,150 results found.

billgallagherlaw.com Ohio Criminal Lawyers: Cincinnati Criminal Defense Attorneys
Cincinnati Ohio criminal lawyers specializing in white collar crime, DUI/DWI defense, fraud, embezzlement, juvenile delinquency, drug possession, traffic violation and appellate cases
Billgallagherlaw.com  ~   Site Info   Whois   Trace Route   RBL Check  
cjd-marseille.net Le CJD Marseille
Le Centre des Jeunes Dirigeants rassemble des chefs d'entreprises et des cadres dirigeants animés par la conviction que l'économie doit être au service de l'homme.
Cjd-marseille.net  ~   Site Info   Whois   Trace Route   RBL Check  
gameyeeeah.com GameYeeeah – Buy Wii, DS, Xbox 360, PS3, PS2, PSP Video Games, Consoles and Accessories Imported from Asia
GameYeeeah is a leading online shopping site of the most popular Wii, DS, Xbox 360, PS3, PS2, PSP video games, consoles and accessories imported from Asia.
Gameyeeeah.com  ~   Site Info   Whois   Trace Route   RBL Check  
harrisonburgspeedingticketlawyer.info Bob Keefer: 27 Years Experience: Harrisonburg and Rockingham Speeding Ticket Lawyer (540) 433-6906 - REVIEWS BY CLIENTS.
For over 25 years, we have been representing people charged with speeding and reckless driving in Virginia. A reckless driving charge is serious; For a free evaluation, call: 540 433-6906.
Harrisonburgspeedingticketlawyer.info  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: harrisonburgspeedingticketlawyer.net - rockinghamspeedingticketlawyer.info - rockinghamspeedingticketlawyer.net
nj-drugcrime.com New Jersey Drug Crime Defense Lawyers - Princeton Drug Possession Defense Attorneys
Arrested in Princeton NJ on felony or misdemeanor drug charges? Contact a New Jersey drug crime defense lawyer at Lependorf & Silverstein. Free consultation.
Nj-drugcrime.com  ~   Site Info   Whois   Trace Route   RBL Check  
russify-it.ru Скачать бесплатные русификаторы программ
Каталог русификаторов программ. Мы собрали русификаторы для всех известных и не очень программ вместе и сделали поиск удобным, чтобы вы всегда нашли тот русификатор, который вам нужен.
Russify-it.ru  ~   Site Info   Whois   Trace Route   RBL Check  
shenandoahrecklessdriving.info Bob Keefer: 27 Years Experience: Shenandoah & Woodstock Reckless Driving and Speeding Ticket Lawyer (540) 433-6906 - REVIEWS BY CLIENTS.
For over 25 years, we have been representing people charged with speeding and reckless driving in Virginia. A reckless driving charge is serious; For a free evaluation, call: 540 433-6906.
Shenandoahrecklessdriving.info  ~   Site Info   Whois   Trace Route   RBL Check  
southlanddetectiveagency.com Florida Private Investigator | Infidelity Adultery Workers Comp Missing Persons Insurance Surveillance Criminal Defense Investigations | Southland Detective Agency LLC
Florida private investigator spies infidelity and catches cheaters, conducts criminal defense and wrongful conviction investigations, background checks and finds missing persons.
Southlanddetectiveagency.com  ~   Site Info   Whois   Trace Route   RBL Check  
virginiarecklessdriving.biz Bob Keefer: 27 Years Experience: Virginia Speeding Ticket & Reckless Driving Lawyer (540) 433-6906 - REVIEWS BY CLIENTS.
For over 25 years, we have been representing people charged with speeding and reckless driving in Virginia. A reckless driving charge is serious; For a free evaluation, call: 540 433-6906.
Virginiarecklessdriving.biz  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: virginiaspeedingticketattorney.info
waynesborodwilawyer.net Bob Keefer: 27 Years Experience: Waynesboro DUI DWI Lawyer (540) 433-6906 - REVIEWS BY CLIENTS.
We have been helping people charged with DWI/DUI for over 25 years. Just because you got charged does not mean you are guilty. For a free case evaluation call: 540 433-6906.
Waynesborodwilawyer.net  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 43/243« Previous4142434445Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com