cbrn - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Cbrn: 335 results found.

homelandsecurityresearch.com » Homeland Security Market Research
Homeland Security Research Corporation (HSRC) provides premium market, technology and industry - expertise that enables clients around the world to gain critical insight into the business opportunities in the Homeland Security market.
Homelandsecurityresearch.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: homelandsecurityresearch.info - homelandsecurityresearch.net - hsrc.biz
pollution.it :: Pollution Group ::
MicroGC, GC-MS, Gascromatografi Portatili, Analizzatori portatili per analisi chimiche, ambientali e di processo, in campo per emergenze CBRN e analisi routinarie, e per monitoraggio continuo. Sensori gas (celle elettrochimiche, MOS, PID, IR), LEL, contaparticelle per analisi polveri. Servizi di monitoraggio, noleggi e service. Settore Ospedaliero: Sistemi SDEGA e monitoraggio ambientale, Prodotti medicali (monitor paziente, elettrobisturi, eografi...), Linea Critical Care. Settore Welfare - Linea Agave: arredi chiavi in mano case di cura e case di riposo, sistemi e ausili.
Pollution.it  ~   Site Info   Whois   Trace Route   RBL Check  
teesvalleyemergencyplanning.info Redirecting to Cleveland Emergency Planning
Information regarding the management of major incidents and disasters in the former Cleveland area
Teesvalleyemergencyplanning.info  ~   Site Info   Whois   Trace Route   RBL Check  
globalstatinc.com Global Statistics, Inc. Home Page
Homepage, Global Statistics, Inc.
Globalstatinc.com  ~   Site Info   Whois   Trace Route   RBL Check  
janesville.bz Janesville Firefighter Turnouts | Firefighter Gear | LION
Janesville Turnouts offer firefighters exceptional thermal protection without limiting mobility. Janesville turnout gear features comfort, safety and durability.
Janesville.bz  ~   Site Info   Whois   Trace Route   RBL Check  
defencivtv.org DEFENCiv|TV - La webTV Sécurité Globale du HCFDC
Le Haut comité français pour la défense civile a pour but de participer à la réflexion sur la doctrine et les techniques de la France en matière de défense et de sécurité civile.
Defencivtv.org  ~   Site Info   Whois   Trace Route   RBL Check  
nationaldefensemegadirectory.com NDIA National Defense Mega Directory
NDIA National Defense Mega Directory - The National Defense Mega Directory is the database dedicated to defense contractors, helping them find the products & services they need.
Nationaldefensemegadirectory.com  ~   Site Info   Whois   Trace Route   RBL Check  
robustresilience.com Robust Resilience
FREE business continuity plan templates and FREE business continuity training modules
Robustresilience.com  ~   Site Info   Whois   Trace Route   RBL Check  
cbrnesecurity.com CBRNEsecurity, LLC
CBRNE Security is a leading innovator of new technologies and detection systems for chemical, biological, radiological, and explosives surveillance. Our services can be tailored to suit your organization's needs and threat level.
Cbrnesecurity.com  ~   Site Info   Whois   Trace Route   RBL Check  
leadertrainer.biz L.E.A.D.E.R. International LLC.
Visit America's #1 Public Safety Trainers
Leadertrainer.biz  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: leadertrainer.com - leadertrainer.info - leadertrainer.mobi - leadertrainer.net - leadertrainer.org - leadertrainershop.com - leadertrainersite.com
 


Page 7/17« Previous56789Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com