aplc - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Aplc: 342 results found.

zinderkoch.com Zinder & Koch, lawyers in Glendale, CA
NORTH HOLLYWOOD, N HOLLYWOOD, CA, California lawyers focusing on, Construction, Employment, Insurance
Zinderkoch.com  ~   Site Info   Whois   Trace Route   RBL Check  
kaisermedicalmalpracticeattorney.com Home
Contact personal injury and medical malpractice attorney Scott S. Harris in San Diego, California, to schedule a free legal consultation. Call 866-934-2432.
Kaisermedicalmalpracticeattorney.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: kaisermedicalmalpracticelawyer.com - scottsharrislaw.com
bbroussardlaw.com Bob Broussard Law | Lafayette Louisiana
Bob Broussard, APLC is a private law corporation devoted to representing those who have been injured. Since 1982, Bob Broussard has handled thousands of personal injury cases, including Jones Act, LHWCA OSCLA, Admiralty and Maritime Law, Fixed Platform and Offshore Injury Cases, and vessel collision.
Bbroussardlaw.com  ~   Site Info   Whois   Trace Route   RBL Check  
disabilitylawfirm.com Home
Experienced Southern California Social Security Disability claims lawyers. Contact us for a free consultation. 1-562-219-4156 or 1-866-764-0321.
Disabilitylawfirm.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: judithleland.com
lymanpotente.biz Bankruptcy And Business . Attorneys At Law . Lyman and Potente
Bankruptcy And Business,Attorneys At Law,Lyman and Potente
Lymanpotente.biz  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: lymanpotente.com - lymanpotente.info - lymanpotente.mobi - lymanpotente.net - lymanpotente.org
fetchmybooks.com Welcome to UrbanGive.com
Give to your organization by your everyday online shopping with UrbanGive.com!
Fetchmybooks.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: urbangive.com
pachowicz.com Home
At the Law Offices of Mark R. Pachowicz, our Ventura County, California lawyers work in criminal law, family law, business law, and other legal matters.
Pachowicz.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: packowicz.com - packowitz.com
sendible.com Social Media Management Software for Businesses: Sendible
Sendible is a social media marketing platform that helps you engage with your audience and promote, track and monitor your brand across multiple social media channels at any time.
Sendible.com  ~   Site Info   Whois   Trace Route   RBL Check  
douglassgilliland.com Douglas S. Gilliland, Esq., Trial Lawyer from San Diego, CA Home
Doug Gilliland lawyer san diego attorney
Douglassgilliland.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: sandiegotriallawyers.com
paulameyerlaw.com Orange CA Real Estate Law Firm | Business & Employment Attorney California Orange County
If you have legal concerns in real estate, business or employment law, contact PAULA E. MEYER & ASSOCIATES, APLC of Orange, California, at 866-409-9415 to schedule an appointment with a qualified attorney.
Paulameyerlaw.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 9/17« Previous7891011Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com